Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50199806 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Uptake Assays |
---|
Ki | 0.940±0.07 nM |
---|
Citation | Newman, AH; Okunola-Bakare, OM; Cao, J Potent and selective inhibitors of monoamine transporters; method of making; and use thereof US Patent US9862679 Publication Date 1/9/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50199806 |
---|
n/a |
---|
Name | BDBM50199806 |
Synonyms: | CHEMBL3944169 | US10913711, Compound 9a | US11555013, Compound 9a | US9862679, Compound 9a |
Type | Small organic molecule |
Emp. Form. | C22H30N2OS |
Mol. Mass. | 370.551 |
SMILES | CC(O)CN1CCN(CCSC(c2ccccc2)c2ccccc2)CC1 |
Structure |
|