Reaction Details |
| Report a problem with these data |
Target | Thymidylate synthase |
---|
Ligand | BDBM20678 |
---|
Substrate/Competitor | BDBM18754 |
---|
Meas. Tech. | Thymidylate Synthase (TS) Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 12000±n/a nM |
---|
Citation | Gangjee, A; Li, W; Yang, J; Kisliuk, RL Design, synthesis, and biological evaluation of classical and nonclassical 2-amino-4-oxo-5-substituted-6-methylpyrrolo[3,2-d]pyrimidines as dual thymidylate synthase and dihydrofolate reductase inhibitors. J Med Chem51:68-76 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Thymidylate synthase |
---|
Name: | Thymidylate synthase |
Synonyms: | TS | TSase | TYSY_ECOLI | Thymidylate Synthase (TS) | thyA |
Type: | Enzyme |
Mol. Mass.: | 30475.81 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 264 |
Sequence: | MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF
DYRFEDFEIEGYDPHPGIKAPVAI
|
|
|
BDBM20678 |
---|
BDBM18754 |
---|
Name | BDBM20678 |
Synonyms: | 2-amino-6-methyl-5-(pyridin-4-ylmethyl)-3H,4H,5H-pyrrolo[3,2-d]pyrimidin-4-one | Pyrrolo[3,2-d]pyrimidine analogue, 6 |
Type | Small organic molecule |
Emp. Form. | C13H13N5O |
Mol. Mass. | 255.2752 |
SMILES | Cc1cc2nc(N)[nH]c(=O)c2n1Cc1ccncc1 |
Structure |
|