Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM198 |
---|
Substrate/Competitor | HIV Protease Chromogenic Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 4.7±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 1.3±0.2 nM |
---|
Citation | Clemente, JC; Robbins, A; Graña, P; Paleo, MR; Correa, JF; Villaverde, MC; Sardina, FJ; Govindasamy, L; Agbandje-McKenna, M; McKenna, R; Dunn, BM; Sussman, F Design, Synthesis, Evaluation, and Crystallographic-Based Structural Studies of HIV-1 Protease Inhibitors with Reduced Response to the V82A Mutation. J Med Chem51:852-60 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease | HIV-1 protease LAI variant |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | The HIV-1 PR DNA for HIV LAI variant was cloned, and protein was expressed, purified, and refolded from Escherichia coli strain BL21. |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM198 |
---|
HIV Protease Chromogenic Peptide Substrate |
---|
Name: | HIV Protease Chromogenic Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1420.11 |
Organism: | n/a |
Description: | n/a |
Residue: | 13 |
Sequence: | |