Reaction Details |
| Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM21623 |
---|
Substrate/Competitor | BDBM21614 |
---|
Meas. Tech. | In Vitro GST Activity Assay |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 17400±n/a nM |
---|
Citation | Hohwy, M; Spadola, L; Lundquist, B; Hawtin, P; Dahmén, J; Groth-Clausen, I; Nilsson, E; Persdotter, S; von Wachenfeldt, K; Folmer, RH; Edman, K Novel prostaglandin d synthase inhibitors generated by fragment-based drug design. J Med Chem51:2178-86 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM21623 |
---|
BDBM21614 |
---|
Name | BDBM21623 |
Synonyms: | 2,4-dichloro-6-(1H-pyrazol-5-yl)phenol | Phenol, 11 |
Type | Small organic molecule |
Emp. Form. | C9H6Cl2N2O |
Mol. Mass. | 229.063 |
SMILES | Oc1c(Cl)cc(Cl)cc1-c1cc[nH]n1 |
Structure |
|