Reaction Details |
 | Report a problem with these data |
Target | Prostaglandin D Synthase |
---|
Ligand | BDBM21627 |
---|
Substrate/Competitor | BDBM21614 |
---|
Meas. Tech. | In Vitro GST Activity Assay |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 75±n/a nM |
---|
Citation | Hohwy M; Spadola L; Lundquist B; Hawtin P; Dahmén J; Groth-Clausen I; Nilsson E; Persdotter S; von Wachenfeldt K; Folmer RH; Edman K Novel prostaglandin d synthase inhibitors generated by fragment-based drug design. J Med Chem 51:2178-86 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Prostaglandin D Synthase |
---|
Name: | Prostaglandin D Synthase |
Synonyms: | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | Prostaglandin D |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM21627 |
---|
BDBM21614 |
---|
Name | BDBM21627 |
Synonyms: | N-[4-methyl-3-({3-[(4-methylpiperazin-1-yl)methyl]benzene}amido)phenyl]-3-phenyl-1,2-thiazole-5-carboxamide | N-{4-methyl-3-[({3-[(4-methylpiperazin-1-yl)methyl]phenyl}carbonyl)amino]phenyl}-3-phenylisothiazole-5-carboxamide | Phenylisothiazole-5-carboxamide, 15 |
Type | Small organic molecule |
Emp. Form. | C30H31N5O2S |
Mol. Mass. | 525.664 |
SMILES | CN1CCN(Cc2cccc(c2)C(=O)Nc2cc(NC(=O)c3cc(ns3)-c3ccccc3)ccc2C)CC1 |
Structure |
|