Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethylthioadenosine Nucleosidase(MTAN)
LigandBDBM22110
Substrate/CompetitorBDBM22111
Meas. Tech.MTAP/MTAN Inhibition Assay
pH7±n/a
Temperature295.15±n/a K
Ki 0.84±0.09 nM
Km430±n/a nM
Citation Evans GBFurneaux RHGreatrex BMurkin ASSchramm VLTyler PC Azetidine based transition state analogue inhibitors of N-ribosyl hydrolases and phosphorylases. J Med Chem 51:948-56 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Methylthioadenosine Nucleosidase(MTAN)
Name:Methylthioadenosine Nucleosidase(MTAN)
Synonyms:5 -methylthioadenosine nucleosidase | 5'-methylthioadenosine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (MTAN) | MTA/SAH nucleosidase | MTAN | P46 | S-adenosylhomocysteine nucleosidase
Type:Enzyme
Mol. Mass.:24347.14
Organism:Escherichia coli (strain K12)
Description:P0AF12
Residue:232
Sequence:
MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT
LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK
ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH
VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22110
BDBM22111
NameBDBM22110
Synonyms:Azetidine based compound, 43 | [1-({4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl}methyl)-3-[(methylsulfanyl)methyl]azetidin-3-yl]methanol
TypeSmall organic molecule
Emp. Form.C13H19N5OS
Mol. Mass.293.388
SMILESCSCC1(CO)CN(Cc2c[nH]c3c(N)ncnc23)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: