| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cellular tumor antigen p53 [16-27]/E3 ubiquitin-protein ligase Mdm2 [23-117] |
|---|
| Ligand | BDBM374759 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Mdm2-p53 Inhibition AlphaScreen |
|---|
| IC50 | 97.0±n/a nM |
|---|
| Citation |  Ramharter, J; Broeker, J; Gille, A; Gollner, A; Henry, M; Kerres, N; Weinstabl, H Spiro[3H-indole-3,2′-pyrrolidin]-2(1H)-one compounds and derivatives as MDM2-p53 inhibitors US Patent US10246467 Publication Date 4/2/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cellular tumor antigen p53 [16-27]/E3 ubiquitin-protein ligase Mdm2 [23-117] |
|---|
| Name: | Cellular tumor antigen p53 [16-27]/E3 ubiquitin-protein ligase Mdm2 [23-117] |
|---|
| Synonyms: | MDM2/P53 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | E3 ubiquitin-protein ligase Mdm2 [23-117] |
|---|
| Synonyms: | E3 ubiquitin-protein ligase Mdm2 (23-117) | MDM2 | MDM2 (aa 23-117) | MDM2_HUMAN |
|---|
| Type: | Oncoprotein |
|---|
| Mol. Mass.: | 11177.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00987[23-117] |
|---|
| Residue: | 95 |
|---|
| Sequence: | EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLL
GDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSD
|
|
|
|---|
| Component 2 |
| Name: | Cellular tumor antigen p53 [16-27] |
|---|
| Synonyms: | P53 | P53 (aa 16-27) | P53_HUMAN | TP53 |
|---|
| Type: | fusion protein |
|---|
| Mol. Mass.: | 1475.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The full-length His6-wt-p53 expressed in E. coli was used in assays. |
|---|
| Residue: | 12 |
|---|
| Sequence: | |
|---|
| BDBM374759 |
|---|
| n/a |
|---|
| Name | BDBM374759 |
|---|
| Synonyms: | US10246467, Example I-45 | US10919913, # I-45 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H25Cl2FN4O4 |
|---|
| Mol. Mass. | 607.459 |
|---|
| SMILES | CC1CC1CN1[C@H]2COc3n(nc4cc(ccc34)C(O)=O)[C@H]2[C@H](c2cccc(Cl)c2F)[C@]11C(=O)Nc2cc(Cl)ccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
