Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMalate dehydrogenase cytoplasmic
LigandBDBM23229
Substrate/CompetitorBDBM23230
Meas. Tech.Lactate Dehydrogenase Inhibition Assay
IC50 6310±n/a nM
Citation Choi SRPradhan AHammond NLChittiboyina AGTekwani BLAvery MA Design, synthesis, and biological evaluation of Plasmodium falciparum lactate dehydrogenase inhibitors. J Med Chem 50:3841-50 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Malate dehydrogenase cytoplasmic
Name:Malate dehydrogenase cytoplasmic
Synonyms:Cytosolic malate dehydrogenase | MDH1 | Malate Dehydrogenase, cytoplasmic
Type:Oxidoreductase; homodimer
Mol. Mass.:36453.77
Organism:Sus scrofa (pig)
Description:Porcine heart cytoplasmic fraction.
Residue:334
Sequence:
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKN
VIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKL
SSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIV
EGLPINDFSREKMDLTAKELAEEKETAFEFLSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23229
BDBM23230
NameBDBM23229
Synonyms:Oxamic acid derivative, 7 | [(4-{2-[(5-hydroxy-2-{[(4-methoxyphenyl)methyl]carbamoyl}-4-oxo-4H-chromen-7-yl)oxy]ethyl}-2-methoxyphenyl)carbamoyl]formic acid
TypeSmall organic molecule
Emp. Form.C29H26N2O10
Mol. Mass.562.5241
SMILESCOc1ccc(CNC(=O)c2cc(=O)c3c(O)cc(OCCc4ccc(NC(=O)C(O)=O)c(OC)c4)cc3o2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: