| Reaction Details |
|---|
 | Report a problem with these data |
| Target | UDP-3-O-acyl-N-acetylglucosamine deacetylase |
|---|
| Ligand | BDBM23442 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | Ligand Affinity Measurements |
|---|
| pH | 7±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Kd | 8600±n/a nM |
|---|
| Citation |  Shin, H; Gennadios, HA; Whittington, DA; Christianson, DW Amphipathic benzoic acid derivatives: synthesis and binding in the hydrophobic tunnel of the zinc deacetylase LpxC. Bioorg Med Chem15:2617-23 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| UDP-3-O-acyl-N-acetylglucosamine deacetylase |
|---|
| Name: | UDP-3-O-acyl-N-acetylglucosamine deacetylase |
|---|
| Synonyms: | LPXC_AQUAE | UDP-3-O-Acyl-GlcNAc Deacetylase (LpxC) | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase | envA | lpxC | zinc deacetylase LpxC |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 32146.02 |
|---|
| Organism: | Aquifex aeolicus |
|---|
| Description: | The enzyme was stripped of all metal ions by dialysis against 1.0 mM EDTA in buffer at room temperature. The EDTA was then removed by extensive dialysis against EDTA-free buffer and the enzyme was reconstituted to a 1:1 Zn2+ to LpxC ratio by the addition of ZnSO4. |
|---|
| Residue: | 282 |
|---|
| Sequence: | MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHST
DLGFKGQRIKTVEHILSVLHLLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNRE
IDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLGRQKFTFVEGNEEEIVLARTF
CFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS
PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL
|
|
|
|---|
| BDBM23442 |
|---|
| BDBM10852 |
|---|
| Name | BDBM23442 |
|---|
| Synonyms: | 4-(heptyloxy)-3-methoxybenzoate | benzoic acid derivative, 11 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H21O4 |
|---|
| Mol. Mass. | 265.3254 |
|---|
| SMILES | CCCCCCCOc1ccc(cc1OC)C([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
