| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM23730 |
|---|
| Substrate/Competitor | BDBM23699 |
|---|
| Meas. Tech. | Human Neutrophil Elastase Inhibition Assay |
|---|
| Ki | 1600±n/a nM |
|---|
| Citation |  Schepetkin, IA; Khlebnikov, AI; Quinn, MT N-benzoylpyrazoles are novel small-molecule inhibitors of human neutrophil elastase. J Med Chem50:4928-38 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM23730 |
|---|
| BDBM23699 |
|---|
| Name | BDBM23730 |
|---|
| Synonyms: | 1,2,4-triazole-5-carboxylate, 14 | methyl 3-[2-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)-3-methylbutanamido]-1H-1,2,4-triazole-5-carboxylate | methyl 3-{[2-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-3-methylbutanoyl]amino}-1H-1,2,4-triazole-5-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N5O5 |
|---|
| Mol. Mass. | 371.3474 |
|---|
| SMILES | COC(=O)c1nnc(NC(=O)C(C(C)C)N2C(=O)c3ccccc3C2=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
