new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitotic checkpoint serine/threonine-protein kinase BUB1
LigandBDBM379108
Substrate/Competitorn/a
Meas. Tech.Bub1 Kinase Assay
IC50 3.40±n/a nM
Citation Hitchcock MMengel APütter VSiemeister GWengner AMBriem HEis KSchulze VFernandez-Montalvan AEPrechtl SHolton SFanghänel JLienau PPreusse CGnoth MJ Substituted benzylindazoles for use as Bub1 kinase inhibitors in the treatment of hyperproliferative diseases US Patent  US10266548 Publication Date 4/23/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Mitotic checkpoint serine/threonine-protein kinase BUB1
Name:Mitotic checkpoint serine/threonine-protein kinase BUB1
Synonyms:BUB1A | hBUB1
Type:PROTEIN
Mol. Mass.:122372.31
Organism:Homo sapiens (Human)
Description:ChEMBL_1510603
Residue:1085
Sequence:
MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKK
KYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASA
VLQRGIQNQAEPREFLQQQYRLFQTRLTETHLPAQARTSEPLHNVQVLNQMITSKSNPGN
NMACISKNQGSELSGVISSACDKESNMERRVITISKSEYSVHSSLASKVDVEQVVMYCKE
KLIRGESEFSFEELRAQKYNQRRKHEQWVNEDRHYMKRKEANAFEEQLLKQKMDELHKKL
HQVVETSHEDLPASQERSEVNPARMGPSVGSQQELRAPCLPVTYQQTPVNMEKNPREAPP
VVPPLANAISAALVSPATSQSIAPPVPLKAQTVTDSMFAVASKDAGCVNKSTHEFKPQSG
AEIKEGCETHKVANTSSFHTTPNTSLGMVQATPSKVQPSPTVHTKEALGFIMNMFQAPTL
PDISDDKDEWQSLDQNEDAFEAQFQKNVRSSGAWGVNKIISSLSSAFHVFEDGNKENYGL
PQPKNKPTGARTFGERSVSRLPSKPKEEVPHAEEFLDDSTVWGIRCNKTLAPSPKSPGDF
TSAAQLASTPFHKLPVESVHILEDKENVVAKQCTQATLDSCEENMVVPSRDGKFSPIQEK
SPKQALSSHMYSASLLRLSQPAAGGVLTCEAELGVEACRLTDTDAAIAEDPPDAIAGLQA
EWMQMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEF
QLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMER
LKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMR
MLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGT
IFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFR
RLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLEC
KRSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM379108
n/a
NameBDBM379108
Synonyms:2-[1-(4-ethoxy-2,6- difluorobenzyl)-1H- indazol-3-yl]-5- (morpholin-2- ylmethoxy)-N- (pyridin-4- yl)pyrimidin-4-amine | US10266548, Example 38-2
TypeSmall organic molecule
Emp. Form.C30H29F2N7O3
Mol. Mass.573.5932
SMILESCCOc1cc(F)c(Cn2nc(-c3ncc(OCC4CNCCO4)c(Nc4ccncc4)n3)c3ccccc23)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: