Reaction Details |
| Report a problem with these data |
Target | Hepatocyte growth factor receptor [1078-1345,H1094R,L1272V] |
---|
Ligand | BDBM24466 |
---|
Substrate/Competitor | biotinylated gastrin substrate |
---|
Meas. Tech. | HTRF Kinase Inhibition Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 0.5±n/a nM |
---|
Citation | Liu, L; Siegmund, A; Xi, N; Kaplan-Lefko, P; Rex, K; Chen, A; Lin, J; Moriguchi, J; Berry, L; Huang, L; Teffera, Y; Yang, Y; Zhang, Y; Bellon, SF; Lee, M; Shimanovich, R; Bak, A; Dominguez, C; Norman, MH; Harmange, JC; Dussault, I; Kim, TS Discovery of a potent, selective, and orally bioavailable c-Met inhibitor: 1-(2-hydroxy-2-methylpropyl)-N-(5-(7-methoxyquinolin-4-yloxy)pyridin-2-yl)-5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazole-4-carboxamide (AMG 458). J Med Chem51:3688-91 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Hepatocyte growth factor receptor [1078-1345,H1094R,L1272V] |
---|
Name: | Hepatocyte growth factor receptor [1078-1345,H1094R,L1272V] |
Synonyms: | HGF/SF receptor | MET | MET_HUMAN | Met proto-oncogene tyrosine kinase | SF receptor | Scatter factor receptor | Tyrosine Kinase c-Met Mutant (H1094R) | c-Met |
Type: | Tyrosine-protein kinase |
Mol. Mass.: | 30595.85 |
Organism: | Homo sapiens (Human) |
Description: | P08581[1078-1345,H1094R,L1272V] |
Residue: | 268 |
Sequence: | VHFNEVIGRGHFGCVYRGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHP
NVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLAS
KKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQT
QKFTTKSDVWSFGVVLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVML
KCWHPKAEMRPSFSELVSRISAIFSTFI
|
|
|
BDBM24466 |
---|
biotinylated gastrin substrate |
---|
Name: | biotinylated gastrin substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2100.22 |
Organism: | n/a |
Description: | n/a |
Residue: | 17 |
Sequence: | |