| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 6 [205-595] |
|---|
| Ligand | BDBM24545 |
|---|
| Substrate/Competitor | BDBM13432 |
|---|
| Meas. Tech. | Phosphatase Activity Assay |
|---|
| IC50 | 60800±n/a nM |
|---|
| Citation |  Lawrence, HR; Pireddu, R; Chen, L; Luo, Y; Sung, SS; Szymanski, AM; Yip, ML; Guida, WC; Sebti, SM; Wu, J; Lawrence, NJ Inhibitors of Src homology-2 domain containing protein tyrosine phosphatase-2 (Shp2) based on oxindole scaffolds. J Med Chem51:4948-56 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 6 [205-595] |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 6 [205-595] |
|---|
| Synonyms: | HCP | Hematopoietic cell protein-tyrosine phosphatase | PTN6_HUMAN | PTP-1C | PTP1C | PTPN6 | Protein-Tyrosine Phosphatase SHP-1 | Protein-tyrosine phosphatase 1C | SH-PTP1 | Tyrosine-protein phosphatase non-receptor type 6 |
|---|
| Type: | Protein phosphatase |
|---|
| Mol. Mass.: | 44886.26 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human recombinant GST-fusion SHP-1 (205-595). |
|---|
| Residue: | 391 |
|---|
| Sequence: | AFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLE
GQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIAS
QGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGE
HDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLP
HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQ
YKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVY
ENLHTKNKREEKVKKQRSADKEKSKGSLKRK
|
|
|
|---|
| BDBM24545 |
|---|
| BDBM13432 |
|---|
| Name | BDBM24545 |
|---|
| Synonyms: | 4-{2-[(3Z)-5-{[(2-chlorophenyl)methyl]sulfamoyl}-2-oxo-2,3-dihydro-1H-indol-3-ylidene]hydrazin-1-yl}benzoic acid | Oxindole scaffold, 10j |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H17ClN4O5S |
|---|
| Mol. Mass. | 484.912 |
|---|
| SMILES | OC(=O)c1ccc(NN=C2C(=O)Nc3ccc(cc23)S(=O)(=O)NCc2ccccc2Cl)cc1 |w:8.7| |
|---|
| Structure | 
|
|---|
Search and Browse
