| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM384079 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Measurement of Interferon Production in Human PBMC |
|---|
| EC50 | 531±n/a nM |
|---|
| Citation |  Bonfanti, J; Doublet, FM; Embrechts, W; Fortin, JM; McGowan, DC; Muller, P; Raboisson, PJ Purine derivatives for the treatment of viral infections US Patent US10280167 Publication Date 5/7/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM384079 |
|---|
| n/a |
|---|
| Name | BDBM384079 |
|---|
| Synonyms: | US10280167, Example 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H17N7O |
|---|
| Mol. Mass. | 383.406 |
|---|
| SMILES | Nc1nc(nc2n(Cc3ccccc3)c(=O)[nH]c12)-c1nc(c[nH]1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
