Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM209 |
---|
Substrate/Competitor | HIV Protease peptide substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 6±n/a |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 76±n/a nM |
---|
Comments | IC50 value had to be determined at suboptimal conditions at pH 6 in order to ensure solubility of inhibitors with different physicochemical properties. |
---|
Citation | Fassler, A; Bold, G; Capraro, HG; Cozens, R; Mestan, J; Poncioni, B; Rosel, J; Tintelnot-Blomley, M; Lang, M Aza-peptide analogs as potent human immunodeficiency virus type-1 protease inhibitors with oral bioavailability. J Med Chem39:3203-16 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM209 |
---|
HIV Protease peptide substrate |
---|
Name: | HIV Protease peptide substrate |
Synonyms: | n/a |
Type: | peptide |
Mol. Mass.: | 2417.69 |
Organism: | synthesized |
Description: | n/a |
Residue: | 20 |
Sequence: | |