| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 13 |
|---|
| Ligand | BDBM25900 |
|---|
| Substrate/Competitor | BDBM10856 |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| Ki | 15±n/a nM |
|---|
| Citation |  Temperini, C; Cecchi, A; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors. Interaction of indapamide and related diuretics with 12 mammalian isozymes and X-ray crystallographic studies for the indapamide-isozyme II adduct. Bioorg Med Chem Lett18:2567-73 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase 13 |
|---|
| Name: | Carbonic anhydrase 13 |
|---|
| Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29522.80 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Murine cloned isozyme |
|---|
| Residue: | 262 |
|---|
| Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
|---|
| BDBM25900 |
|---|
| BDBM10856 |
|---|
| Name | BDBM25900 |
|---|
| Synonyms: | 2-chloro-5-(1-hydroxy-3-oxo-2,3-dihydro-1H-isoindol-1-yl)benzene-1-sulfonamide | Chlortalidone | Chlorthalidone | Chlorthalidone (1) | Hygroton | Phthalamudine | US10172837, Chlorthalidone |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11ClN2O4S |
|---|
| Mol. Mass. | 338.766 |
|---|
| SMILES | NS(=O)(=O)c1cc(ccc1Cl)C1(O)NC(=O)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
