Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PLK2
LigandBDBM25121
Substrate/CompetitorSer/Thr 16 Peptide
Meas. Tech.Enzymatic Activity Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 16.8±7.4 nM
Citation Kothe MKohls DLow SColi RRennie GRFeru FKuhn CDing YH Selectivity-determining residues in Plk1. Chem Biol Drug Des 70:540-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase PLK2
Name:Serine/threonine-protein kinase PLK2
Synonyms:Polo-Like Kinase 2 | Serine/threonine-protein kinase PLK2 | Serine/threonine-protein kinase SNK | Serum-inducible kinase
Type:Serine/threonine-protein kinase
Mol. Mass.:78259.87
Organism:Homo sapiens (Human)
Description:Full-length human PLK2 was expressed as GST-fusion protein using baculovirus expression system. GST-PLK2 was purified by using glutathione sepharose chromatography.
Residue:685
Sequence:
MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHH
HHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSSELKNRMEYALNMLLQRCN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25121
Ser/Thr 16 Peptide
Name:Ser/Thr 16 Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:SelectScreen Biochemical Kinase Profiling Service (Invitrogen Corporation, Carlsbad, CA, USA).
Residue:3
Sequence:
n/a