Reaction Details |
| Report a problem with these data |
Target | DNA-(apurinic or apyrimidinic site) endonuclease |
---|
Ligand | BDBM26613 |
---|
Substrate/Competitor | DNA Substrate |
---|
Meas. Tech. | High-Throughput Screening and IC50 Determinations |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 200±100 nM |
---|
Comments | 98% Inhibition uM. |
---|
Citation | Seiple, LA; Cardellina, JH; Akee, R; Stivers, JT Potent inhibition of human apurinic/apyrimidinic endonuclease 1 by arylstibonic acids. Mol Pharmacol73:669-77 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
DNA-(apurinic or apyrimidinic site) endonuclease |
---|
Name: | DNA-(apurinic or apyrimidinic site) endonuclease |
Synonyms: | APE | APE1 | APEX | APEX1 | APEX1_HUMAN | APX | Apurinic-apyrimidinic endonuclease 1 (APE-1) | Apurinic/apyrimidinic endonuclease 1 (APE1) | DNA-(apurinic or apyrimidinic site) lyase | HAP1 | REF1 |
Type: | Protein |
Mol. Mass.: | 35560.12 |
Organism: | Homo sapiens (Human) |
Description: | P27695 |
Residue: | 318 |
Sequence: | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPA
TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWS
APSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLV
RLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGF
GELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL
|
|
|
BDBM26613 |
---|
DNA Substrate |
---|
Name: | DNA Substrate |
Synonyms: | Annealed double-stranded oligonucleotide with an abasic site. |
Type: | Fluorescent substrate |
Mol. Mass.: | 1563.78 |
Organism: | n/a |
Description: | The top strand is 5-FAM-GAG AA(F) ATA GTC GCG-3 containing the tetrahydrofuran synthetic abasic residue (F). |
Residue: | 18 |
Sequence: | 5-FAM-GAG AA(F) ATA GTC GCG-3
|
|
|