| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Monoacylglycerol lipase ABHD6 |
|---|
| Ligand | BDBM26736 |
|---|
| Substrate/Competitor | BDBM26737 |
|---|
| Meas. Tech. | Serine Hydrolase Activity Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 0.09±n/a nM |
|---|
| Citation |  Alexander, JP; Cravatt, BF The putative endocannabinoid transport blocker LY2183240 is a potent inhibitor of FAAH and several other brain serine hydrolases. J Am Chem Soc128:9699-704 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Monoacylglycerol lipase ABHD6 |
|---|
| Name: | Monoacylglycerol lipase ABHD6 |
|---|
| Synonyms: | ABHD6_MOUSE | Abh6 | Abhd6 | Abhydrolase Domain-Containing Protein 6 | Monoacylglycerol lipase ABHD6 |
|---|
| Type: | Single-pass type II membrane protein; hydrolase |
|---|
| Mol. Mass.: | 38216.17 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Assays were using membranes of recombinant Abh6 transiently transfected in COS-7 cells. |
|---|
| Residue: | 336 |
|---|
| Sequence: | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
|
|
|
|---|
| BDBM26736 |
|---|
| BDBM26737 |
|---|
| Name | BDBM26736 |
|---|
| Synonyms: | CHEMBL509860 | LY2183240 | N,N-dimethyl-5-[(4-phenylphenyl)methyl]-1H-1,2,3,4-tetrazole-1-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N5O |
|---|
| Mol. Mass. | 307.3498 |
|---|
| SMILES | CN(C)C(=O)n1nnnc1Cc1ccc(cc1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
