Reaction Details |
| Report a problem with these data |
Target | C-C motif chemokine 3 |
---|
Ligand | BDBM77015 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | cytomteric bead array (CBA) assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 450±n/a nM |
---|
Comments | extracted |
---|
Citation | Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-C motif chemokine 3 |
---|
Name: | C-C motif chemokine 3 |
Synonyms: | CCL3 | CCL3_HUMAN | G0/G1 switch regulatory protein 19-1 | G0S19-1 | MIP-1-alpha | MIP1A | Macrophage inflammatory protein 1-alpha | PAT 464.1 | SCYA3 | SIS-beta | Small-inducible cytokine A3 | Tonsillar lymphocyte LD78 alpha protein |
Type: | Protein |
Mol. Mass.: | 10083.38 |
Organism: | Homo sapiens (Human) |
Description: | P10147 |
Residue: | 92 |
Sequence: | MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
|
|
|
BDBM77015 |
---|
n/a |
---|
Name | BDBM77015 |
Synonyms: | (R)-3-(4-((4-(morpholinomethyl)benzyl)-oxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione | US9694015, 6.4R |
Type | Small organic molecule |
Emp. Form. | C25H27N3O5 |
Mol. Mass. | 449.499 |
SMILES | O=C1N(Cc2c1cccc2OCc1ccc(CN2CCOCC2)cc1)[C@@H]1CCC(=O)NC1=O |r| |
Structure |
|