Reaction Details |
| Report a problem with these data |
Target | C-C motif chemokine 4 |
---|
Ligand | BDBM77015 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | cytomteric bead array (CBA) assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | >10000±n/a nM |
---|
Comments | extracted |
---|
Citation | Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-C motif chemokine 4 |
---|
Name: | C-C motif chemokine 4 |
Synonyms: | ACT-2 | CCL4 | CCL4_HUMAN | G-26 T-lymphocyte-secreted protein | HC21 | LAG-1 | LAG1 | Lymphocyte activation gene 1 protein | MIP-1-beta | MIP1B | Macrophage inflammatory protein 1-beta | PAT 744 | Protein H400 | SCYA4 | SIS-gamma | Small-inducible cytokine A4 | T-cell activation protein 2 |
Type: | Protein |
Mol. Mass.: | 10210.74 |
Organism: | Homo sapiens (Human) |
Description: | P13236 |
Residue: | 92 |
Sequence: | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
|
|
|
BDBM77015 |
---|
n/a |
---|
Name | BDBM77015 |
Synonyms: | (R)-3-(4-((4-(morpholinomethyl)benzyl)-oxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione | US9694015, 6.4R |
Type | Small organic molecule |
Emp. Form. | C25H27N3O5 |
Mol. Mass. | 449.499 |
SMILES | O=C1N(Cc2c1cccc2OCc1ccc(CN2CCOCC2)cc1)[C@@H]1CCC(=O)NC1=O |r| |
Structure |
|