| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Granulocyte-macrophage colony-stimulating factor |
|---|
| Ligand | BDBM65497 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | cytomteric bead array (CBA) assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 2.20±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Granulocyte-macrophage colony-stimulating factor |
|---|
| Name: | Granulocyte-macrophage colony-stimulating factor |
|---|
| Synonyms: | CSF | CSF2 | CSF2_HUMAN | Colony-stimulating factor | GM-CSF | GMCSF | Molgramostin | Sargramostim |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 16291.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P04141 |
|---|
| Residue: | 144 |
|---|
| Sequence: | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
|
|
|
|---|
| BDBM65497 |
|---|
| n/a |
|---|
| Name | BDBM65497 |
|---|
| Synonyms: | CC-220 (Compound 6) | US9694015, 6.4S |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27N3O5 |
|---|
| Mol. Mass. | 449.499 |
|---|
| SMILES | O=C1N(Cc2c1cccc2OCc1ccc(CN2CCOCC2)cc1)[C@H]1CCC(=O)NC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
