Reaction Details |
| Report a problem with these data |
Target | Interleukin-6 |
---|
Ligand | BDBM76986 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | cytomteric bead array (CBA) assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 60±n/a nM |
---|
Comments | extracted |
---|
Citation | Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-6 |
---|
Name: | Interleukin-6 |
Synonyms: | B-cell stimulatory factor 2 | BSF-2 | CDF | CTL differentiation factor | Hybridoma growth factor | IFN-beta-2 | IFNB2 | IL-6 | IL6 | IL6_HUMAN | Interferon beta-2 |
Type: | n/a |
Mol. Mass.: | 23717.96 |
Organism: | Homo sapiens (Human) |
Description: | P05231 |
Residue: | 212 |
Sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
|
|
BDBM76986 |
---|
n/a |
---|
Name | BDBM76986 |
Synonyms: | 3-(5-amino-2-methyl-4-oxo-4H-quinazolin-3-yl)-piperidine-2,6-dione | US11059801, Compound D-17 | US9694015, Compound A |
Type | Small organic molecule |
Emp. Form. | C14H14N4O3 |
Mol. Mass. | 286.286 |
SMILES | Cc1nc2cccc(N)c2c(=O)n1C1CCC(=O)NC1=O |
Structure |
|