Reaction Details |
| Report a problem with these data |
Target | Granulocyte-macrophage colony-stimulating factor |
---|
Ligand | BDBM65456 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | cytomteric bead array (CBA) assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 1500±n/a nM |
---|
Comments | extracted |
---|
Citation | Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Granulocyte-macrophage colony-stimulating factor |
---|
Name: | Granulocyte-macrophage colony-stimulating factor |
Synonyms: | CSF | CSF2 | CSF2_HUMAN | Colony-stimulating factor | GM-CSF | GMCSF | Molgramostin | Sargramostim |
Type: | Protein |
Mol. Mass.: | 16291.07 |
Organism: | Homo sapiens (Human) |
Description: | P04141 |
Residue: | 144 |
Sequence: | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
|
|
|
BDBM65456 |
---|
n/a |
---|
Name | BDBM65456 |
Synonyms: | 19171-19-8 | 4-amino-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione | Actimid | CC-4047 | Pomalyst | US11059801, Compound D-4 | US20230271966, Compound Pomalidomide | US9694015, 6.2 | pomalidomide |
Type | Small organic molecule |
Emp. Form. | C13H11N3O4 |
Mol. Mass. | 273.2441 |
SMILES | Nc1cccc2C(=O)N(C3CCC(=O)NC3=O)C(=O)c12 |
Structure |
|