| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-6 |
|---|
| Ligand | BDBM65454 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | cytomteric bead array (CBA) assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 1200±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-6 |
|---|
| Name: | Interleukin-6 |
|---|
| Synonyms: | B-cell stimulatory factor 2 | BSF-2 | CDF | CTL differentiation factor | Hybridoma growth factor | IFN-beta-2 | IFNB2 | IL-6 | IL6 | IL6_HUMAN | Interferon beta-2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 23717.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05231 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
|
|
|---|
| BDBM65454 |
|---|
| n/a |
|---|
| Name | BDBM65454 |
|---|
| Synonyms: | 191732-72-6 | CC-5013 | Lenalidomide | Revimid | Revlimid | US11530219, Compound Lenalidomide | US9694015, 6.1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H13N3O3 |
|---|
| Mol. Mass. | 259.2606 |
|---|
| SMILES | Nc1cccc2C(=O)N(Cc12)C1CCC(=O)NC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
