| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-1 beta |
|---|
| Ligand | BDBM65454 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | cytomteric bead array (CBA) assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 390±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-1 beta |
|---|
| Name: | Interleukin-1 beta |
|---|
| Synonyms: | IL1B | IL1B_HUMAN | IL1F2 | Interleukin 1-beta | Interleukin-1 beta | hIL-1beta |
|---|
| Type: | Cytokine |
|---|
| Mol. Mass.: | 30734.47 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01584 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
|
|
|
|---|
| BDBM65454 |
|---|
| n/a |
|---|
| Name | BDBM65454 |
|---|
| Synonyms: | 191732-72-6 | CC-5013 | Lenalidomide | Revimid | Revlimid | US11530219, Compound Lenalidomide | US9694015, 6.1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H13N3O3 |
|---|
| Mol. Mass. | 259.2606 |
|---|
| SMILES | Nc1cccc2C(=O)N(Cc12)C1CCC(=O)NC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
