Reaction Details |
| Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM77003 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | cytomteric bead array (CBA) assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 0.52±n/a nM |
---|
Comments | extracted |
---|
Citation | Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM77003 |
---|
n/a |
---|
Name | BDBM77003 |
Synonyms: | 3-(1-oxo-4-(4-(2-(pyrrolidin-1-yl)ethoxy)benzyloxy)isoindolin-2-yl)-piperidine-2,6-dione | US9694015, 6.5 | US9694015, Compound B |
Type | Small organic molecule |
Emp. Form. | C26H29N3O5 |
Mol. Mass. | 463.5256 |
SMILES | O=C1N(Cc2c1cccc2OCc1ccc(OCCN2CCCC2)cc1)C1CCC(=O)NC1=O |$;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;HN;;$| |
Structure |
|