| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM320 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| IC50 | 1.3±n/a nM |
|---|
| Comments | k311r366 |
|---|
| Citation |  Hornback, WJ; Munroe, JE; Shepherd, TA; Hatch, SD; Muesing, MA; Wiskerchen, M; Colacino, JM; Baxter, AJ SYNTHESIS AND PHARMACOKINETICS OF POTENT CARBAMATE HIV-1 PROTEASE INHIBITORS CONTAINING NOVEL HIGH AFFINITY HYDROXYETHYLAMINE ISOSTERES Bioorg Med Chem Lett5:2891-6 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM320 |
|---|
| n/a |
|---|
| Name | BDBM320 |
|---|
| Synonyms: | (2R,3R)-1,1-dioxo-2-(propan-2-yl)--thiolan-3-yl N-[(2S,3R)-4-[(3aR,7aS)-6-(tert-butylcarbamoyl)-octahydrothieno[3,2-c]pyridin-5-yl]-3-hydroxy-1-phenylbutan-2-yl]carbamate | Thienopyridine thienyl urethane deriv. 15 | hydroxyethylamine isostere | hydroxyethylene isostere |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H47N3O6S2 |
|---|
| Mol. Mass. | 609.841 |
|---|
| SMILES | [H][C@]12CCS[C@@]1([H])CC(N(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)O[C@@H]1CCS(=O)(=O)[C@@H]1C(C)C)C2)C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
