| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Ligand | BDBM391825 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biological Assays |
|---|
| Ki | <25000±n/a nM |
|---|
| Citation |  Pache, L; Chanda, SK; Vamos, MD; Cosford, ND; Teriete, P; Marlett, J; Diaz, A; Young, JA Use of inhibitor of apoptosis protein (IAP) antagonists in HIV therapy US Patent US10300074 Publication Date 5/28/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Synonyms: | API3 | BIR3 (aa 241-356) | BIR3 domain | BIRC4 | IAP3 | XIAP | XIAP Bir3 | XIAP_HUMAN | amino acids 241-356 of XIAP |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 14548.06 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P98170[241-356] |
|---|
| Residue: | 125 |
|---|
| Sequence: | MRHHHHHHRSDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYA
LGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEEC
LVRTT
|
|
|
|---|
| BDBM391825 |
|---|
| n/a |
|---|
| Name | BDBM391825 |
|---|
| Synonyms: | US10300074, Compd 20 | US10300074, Compd 21 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H37N5O4 |
|---|
| Mol. Mass. | 483.6031 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@H]1CCCN(C2CCC(N2C1=O)C(=O)NC1CCCc2ccccc12)C(C)=O |r,w:13.12,15.20| |
|---|
| Structure | 
|
|---|
Search and Browse
