Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50409138 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
IC50 | 2.2±n/a nM |
---|
Citation | Boyer, FE; Vara Prasad, JV; Domagala, JM; Ellsworth, EL; Gajda, C; Hagen, SE; Markoski, LJ; Tait, BD; Lunney, EA; Palovsky, A; Ferguson, D; Graham, N; Holler, T; Hupe, D; Nouhan, C; Tummino, PJ; Urumov, A; Zeikus, E; Zeikus, G; Gracheck, SJ; Sanders, JM; VanderRoest, S; Brodfuehrer, J; Iyer, K; Sinz, M; Gulnik, SV 5,6-Dihydropyran-2-ones possessing various sulfonyl functionalities: potent nonpeptidic inhibitors of HIV protease. J Med Chem43:843-58 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50409138 |
---|
n/a |
---|
Name | BDBM50409138 |
Synonyms: | CHEMBL171229 |
Type | Small organic molecule |
Emp. Form. | C31H38N2O7S2 |
Mol. Mass. | 614.773 |
SMILES | CCCC1(CCc2ccc(O)cc2)CC(=O)C(Sc2cc(C)c(OS(=O)(=O)Cn3ccnc3)cc2C(C)(C)C)C(=O)O1 |
Structure |
|