| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-carbonic anhydrase 1 |
|---|
| Ligand | BDBM10866 |
|---|
| Substrate/Competitor | BDBM10856 |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| pH | 8.3±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 8100±n/a nM |
|---|
| Citation |  Minakuchi, T; Nishimori, I; Vullo, D; Scozzafava, A; Supuran, CT Molecular cloning, characterization, and inhibition studies of the Rv1284 beta-carbonic anhydrase from Mycobacterium tuberculosis with sulfonamides and a sulfamate. J Med Chem52:2226-32 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Beta-carbonic anhydrase 1 |
|---|
| Name: | Beta-carbonic anhydrase 1 |
|---|
| Synonyms: | β-Carbonic anhydrase 1 (CA 1) | Carbonic Anhydrase (mtCA 1) | MTCA1_MYCTU | Uncharacterized protein Rv1284/MT1322 | canA | mtcA1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18186.06 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays. |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
|
|
|
|---|
| BDBM10866 |
|---|
| BDBM10856 |
|---|
| Name | BDBM10866 |
|---|
| Synonyms: | 4-amino-6-(trifluoromethyl)benzene-1,3-disulfonamide | CHEMBL418 | aromatic/heteroaromatic sulfonamide 11 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H8F3N3O4S2 |
|---|
| Mol. Mass. | 319.281 |
|---|
| SMILES | Nc1cc(c(cc1S(N)(=O)=O)S(N)(=O)=O)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
