Reaction Details |
| Report a problem with these data |
Target | Beta-carbonic anhydrase 1 |
---|
Ligand | BDBM10889 |
---|
Substrate/Competitor | BDBM10856 |
---|
Meas. Tech. | CA Inhibition Assay |
---|
Ki | 2300±n/a nM |
---|
Citation | Minakuchi, T; Nishimori, I; Vullo, D; Scozzafava, A; Supuran, CT Molecular cloning, characterization, and inhibition studies of the Rv1284 beta-carbonic anhydrase from Mycobacterium tuberculosis with sulfonamides and a sulfamate. J Med Chem52:2226-32 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Beta-carbonic anhydrase 1 |
---|
Name: | Beta-carbonic anhydrase 1 |
Synonyms: | β-Carbonic anhydrase 1 (CA 1) | Carbonic Anhydrase (mtCA 1) | MTCA1_MYCTU | Uncharacterized protein Rv1284/MT1322 | canA | mtcA1 |
Type: | Enzyme |
Mol. Mass.: | 18186.06 |
Organism: | Mycobacterium tuberculosis |
Description: | The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays. |
Residue: | 163 |
Sequence: | MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
|
|
|
BDBM10889 |
---|
BDBM10856 |
---|
Name | BDBM10889 |
Synonyms: | 2-methoxy-N-[(1-methylpyrrolidin-2-yl)methyl]-5-sulfamoylbenzamide | Sulmepride | Sulpiride (SLP) |
Type | Small organic molecule |
Emp. Form. | C14H21N3O4S |
Mol. Mass. | 327.399 |
SMILES | COc1ccc(cc1C(=O)NCC1CCCN1C)S(N)(=O)=O |
Structure |
|