| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcription activator BRG1 [1448-1575] |
|---|
| Ligand | BDBM394475 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | BRG1 TR-FRET Binding Assay |
|---|
| IC50 | 6.70±n/a nM |
|---|
| Citation |  Albrecht, BK; Cote, A; Crawford, T; Duplessis, M; Good, AC; LeBlanc, Y; Magnuson, SR; Nasveschuk, CG; Romero, FA; Tang, Y; Taylor, AM Therapeutic compounds and uses thereof US Patent US10308614 Publication Date 6/4/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcription activator BRG1 [1448-1575] |
|---|
| Name: | Transcription activator BRG1 [1448-1575] |
|---|
| Synonyms: | ATP-dependent helicase SMARCA4 | BAF190A | BRG1 | His-BRG1 (A1448-S1575) | SMARCA4 | SMCA4_HUMAN | SNF2B | SNF2L4 | Transcription activator BRG1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 14937.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P51532(A1448-S1575) |
|---|
| Residue: | 128 |
|---|
| Sequence: | AEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDF
KKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE
DDSEGEES
|
|
|
|---|
| BDBM394475 |
|---|
| n/a |
|---|
| Name | BDBM394475 |
|---|
| Synonyms: | 2-(6-amino-5-(8-(4- | US10308614, Example 76 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22FN5O |
|---|
| Mol. Mass. | 391.4414 |
|---|
| SMILES | Nc1nnc(cc1N1CC2CCC(C1)N2c1ccc(F)cc1)-c1ccccc1O |TLB:15:14:7.8.13:10.11| |
|---|
| Structure | 
|
|---|
Search and Browse
