Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM613 |
---|
Substrate/Competitor | Peptide substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 6±n/a |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 2.4±n/a nM |
---|
Citation | Humber, DC; Bamford, MJ; Bethell, RC; Cammack, N; Cobley, K; Evans, DN; Gray, NM; Hann, MM; Orr, DC; Saunders, J A series of penicillin derived C2-symmetric inhibitors of HIV-1 proteinase: synthesis, mode of interaction, and structure-activity relationships. J Med Chem36:3120-8 (1993) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM613 |
---|
Peptide substrate |
---|
Name: | Peptide substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1467.64 |
Organism: | n/a |
Description: | n/a |
Residue: | 13 |
Sequence: | |