Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1E |
---|
Ligand | BDBM31352 |
---|
Substrate/Competitor | Not Available |
---|
Meas. Tech. | Counterscreen assay for S1P3 antagonists: Dose response cell-based high throughput screening assay to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) |
---|
pH | 7.4±n/a |
---|
Temperature | 296.15±n/a K |
---|
IC50 | 1852±n/a nM |
---|
Citation | PubChem, PC Counterscreen assay for S1P3 antagonists: Dose response cell-based high throughput screening assay to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
5-hydroxytryptamine receptor 1E |
---|
Name: | 5-hydroxytryptamine receptor 1E |
Synonyms: | 5-HT-1E | 5-HT1E | 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) | 5-hydroxytryptamine receptor 1E | 5-hydroxytryptamine receptor 1E (5-HT-1E) (S31) | 5-hydroxytryptamine receptor 1E (5-HT-1E) (Serotonin receptor 1E) (5-HT1E) (S31). | 5HT1E_HUMAN | HTR1E | S31 | Serotonin (5-HT) receptor | Serotonin 1e (5-HT1e) receptor | Serotonin Receptor 1E |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41697.80 |
Organism: | Homo sapiens (Human) |
Description: | gi_112822 |
Residue: | 365 |
Sequence: | MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
|
|
|
BDBM31352 |
---|
Not Available |
---|
Name: | Not Available |
Synonyms: | n/a |
Type: | n/a |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | n/a |
Residue: | 3 |
Sequence: | |