Reaction Details |
| Report a problem with these data |
Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Ligand | BDBM31914 |
---|
Substrate/Competitor | BDBM10852 |
---|
Meas. Tech. | SPR Biosensor Assay |
---|
pH | 7±n/a |
---|
Temperature | 283.15±n/a K |
---|
Kd | 2020000±420000 nM |
---|
Citation | Ramsden, NL; Buetow, L; Dawson, A; Kemp, LA; Ulaganathan, V; Brenk, R; Klebe, G; Hunter, WN A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy. J Med Chem52:2531-42 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
Synonyms: | 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase (IspF) | ISPF_ECOLI | MECDP-synthase | MECPS | ispF | mecS | ygbB |
Type: | Homotrimer |
Mol. Mass.: | 16897.34 |
Organism: | Escherichia coli (strain K12) |
Description: | P62617 |
Residue: | 159 |
Sequence: | MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
|
|
|
BDBM31914 |
---|
BDBM10852 |
---|
Name | BDBM31914 |
Synonyms: | 4-amino-1-[(2R,3R,4S,5R)-3, 4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-fluoropyrimidin-2-one | 5-fluorocytidine | FLUC |
Type | n/a |
Emp. Form. | C9H12FN3O5 |
Mol. Mass. | 261.2071 |
SMILES | Nc1nc(=O)n(cc1F)[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O |
Structure |
|