| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sortase family protein |
|---|
| Ligand | BDBM33308 |
|---|
| Substrate/Competitor | BDBM33299 |
|---|
| Meas. Tech. | Fluorescence Resonance Energy Transfer (FRET) Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 186000±22000 nM |
|---|
| Citation |  Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT Discovery and structure-activity relationship analysis of Staphylococcus aureus sortase A inhibitors. Bioorg Med Chem17:7174-85 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Sortase family protein |
|---|
| Name: | Sortase family protein |
|---|
| Synonyms: | Sortase | Sortase A (SrtA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23546.15 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
LITCDDYNEKTGVWEKRKIFVATEVK
|
|
|
|---|
| BDBM33308 |
|---|
| BDBM33299 |
|---|
| Name | BDBM33308 |
|---|
| Synonyms: | rhodanine, 1-9 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15NO2S2 |
|---|
| Mol. Mass. | 329.436 |
|---|
| SMILES | CCCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
