Reaction Details |
| Report a problem with these data |
Target | Sortase A |
---|
Ligand | BDBM33312 |
---|
Substrate/Competitor | BDBM33299 |
---|
Meas. Tech. | Fluorescence Resonance Energy Transfer (FRET) Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 27000±9000 nM |
---|
Citation | Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT Discovery and structure-activity relationship analysis of Staphylococcus aureus sortase A inhibitors. Bioorg Med Chem17:7174-85 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Sortase A |
---|
Name: | Sortase A |
Synonyms: | LPXTG-site transpeptidase family protein | SRTA_BACAN | Sortase A (SrtA) | srtA |
Type: | Enzyme |
Mol. Mass.: | 23150.63 |
Organism: | Bacillus anthracis |
Description: | A0A0E0VVI0 |
Residue: | 210 |
Sequence: | MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASK
IDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGN
YALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKD
EITLITCVSVKDNSKRYVVAGDLVGTKAKK
|
|
|
BDBM33312 |
---|
BDBM33299 |
---|
Name | BDBM33312 |
Synonyms: | rhodanine, 1-13 |
Type | Small organic molecule |
Emp. Form. | C17H13NO2S2 |
Mol. Mass. | 327.421 |
SMILES | C=CCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2)C1=O |
Structure |
|