Reaction Details |
| Report a problem with these data |
Target | Sortase A |
---|
Ligand | BDBM33371 |
---|
Substrate/Competitor | BDBM33299 |
---|
Meas. Tech. | Fluorescence Resonance Energy Transfer (FRET) Assay |
---|
IC50 | 1400±n/a nM |
---|
Citation | Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT Discovery and structure-activity relationship analysis of Staphylococcus aureus sortase A inhibitors. Bioorg Med Chem17:7174-85 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Sortase A |
---|
Name: | Sortase A |
Synonyms: | LPXTG-site transpeptidase family protein | SRTA_BACAN | Sortase A (SrtA) | srtA |
Type: | Enzyme |
Mol. Mass.: | 23150.63 |
Organism: | Bacillus anthracis |
Description: | A0A0E0VVI0 |
Residue: | 210 |
Sequence: | MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASK
IDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGN
YALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKD
EITLITCVSVKDNSKRYVVAGDLVGTKAKK
|
|
|
BDBM33371 |
---|
BDBM33299 |
---|
Name | BDBM33371 |
Synonyms: | pyrazolethione, 3-9 |
Type | Small organic molecule |
Emp. Form. | C23H19N5S |
Mol. Mass. | 397.495 |
SMILES | Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(cc1)N=Nc1ccccc1 |w:13.14,21.23| |
Structure |
|