Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM35031 |
---|
Substrate/Competitor | Biotinylated Substrate Peptide |
---|
Meas. Tech. | Pim Kinase Assay |
---|
Temperature | 298.15±n/a K |
---|
Ki | 3±n/a nM |
---|
Comments | extracted |
---|
Citation | Tao, ZF; Hasvold, LA; Leverson, JD; Han, EK; Guan, R; Johnson, EF; Stoll, VS; Stewart, KD; Stamper, G; Soni, N; Bouska, JJ; Luo, Y; Sowin, TJ; Lin, NH; Giranda, VS; Rosenberg, SH; Penning, TD Discovery of 3H-benzo[4,5]thieno[3,2-d]pyrimidin-4-ones as potent, highly selective, and orally bioavailable inhibitors of the human protooncogene proviral insertion site in moloney murine leukemia virus (PIM) kinases. J Med Chem52:6621-36 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM35031 |
---|
Biotinylated Substrate Peptide |
---|
Name: | Ryanodine receptor 1 [4317-4329] |
Synonyms: | Biotinylated Substrate Peptide | RYDR | RYR1 | RYR1_HUMAN |
Type: | Peptide |
Mol. Mass.: | 2871.44 |
Organism: | n/a |
Description: | P21817[4317-4329] |
Residue: | 24 |
Sequence: | biotin-C6linker-VRRLRRLTAREAA
|
|
|