| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM821 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | <0.200000±n/a nM |
|---|
| Citation |  Munroe, JE; Shepherd, TA; Jungheim, LN; Hornback, WJ; Hatch, SD; Muesing, MA; Wiskerchen, M; Su, KS; Campanale, KM; Baxter, AJ; Colacino, JM Potent, orally bioavailable HIV-1 protease inhibitors containing noncoded D-amino acids Bioorg Med Chem Lett5:2897-902 (1995) |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM821 |
|---|
| n/a |
|---|
| Name | BDBM821 |
|---|
| Synonyms: | (3aR,6S,7aS)-N-tert-butyl-5-[(2R,3S)-2-hydroxy-3-[(2S)-3-(naphthalene-2-sulfonyl)-2-(2,2,2-trifluoroacetamido)propanamido]-4-phenylbutyl]-octahydrothieno[3,2-c]pyridine-6-carboxamide | Saquinavir/Nelfinavir deriv. 25 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H45F3N4O6S2 |
|---|
| Mol. Mass. | 762.902 |
|---|
| SMILES | [H][C@]12CCS[C@@]1([H])C[C@H](N(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](CS(=O)(=O)c1ccc3ccccc3c1)NC(=O)C(F)(F)F)C2)C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
