Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium-dependent protein kinase 1
LigandBDBM36336
Substrate/Competitorn/a
Meas. Tech.Parasite Proliferation Assay
pH7.5±0
Temperature297.15±0 K
EC50 230±0.0 nM
Citation Kato NSakata TBreton GLe Roch KGNagle AAndersen CBursulaya BHenson KJohnson JKumar KAMarr FMason DMcNamara CPlouffe DRamachandran VSpooner MTuntland TZhou YPeters ECChatterjee ASchultz PGWard GEGray NHarper JWinzeler EA Gene expression signatures and small-molecule compounds link a protein kinase to Plasmodium falciparum motility. Nat Chem Biol 4:347-56 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Calcium-dependent protein kinase 1
Name:Calcium-dependent protein kinase 1
Synonyms:Calcium-dependent protein kinase 1 | PfCDPK1
Type:PROTEIN
Mol. Mass.:60804.87
Organism:Plasmodium Falciparum
Description:P62343
Residue:524
Sequence:
MGCSQSSNVKDFKTRRSKFTNGNNYGKSGNNKNSEDLAINPGMYVRKKEGKIGESYFKVR
KLGSGAYGEVLLCREKHGHGEKAIKVIKKSQFDKMKYSITNKIECDDKIHEEIYNEISLL
KSLDHPNIIKLFDVFEDKKYFYLVTEFYEGGELFEQIINRHKFDECDAANIMKQILSGIC
YLHKHNIVHRDIKPENILLENKHSLLNIKIVDFGLSSFFSKDNKLRDRLGTAYYIAPEVL
RKKYNEKCDVWSCGVILYILLCGYPPFGGQNDQDIIKKVEKGKYYFDFNDWKNISEEAKE
LIKLMLTYDYNKRITAKEALNSKWIKKYANNINKSDQKTLCGALSNMRKFEGSQKLAQAA
ILFIGSKLTTLEERKELTDIFKKLDKNGDGQLDKKELIEGYNILRSFKNELGELKNVEEE
VDNILKEVDFDKNGYIEYSEFISVCMDKQILFSEERLRDAFNLFDTDKSGKITKEELANL
FGLTSISEQMWNEVLGEADKNKDNMIDFDEFVNMMHKICDNKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36336
n/a
NameBDBM36336
Synonyms:CID24762166 | Purfalcamine, 1
TypeSmall organic molecule
Emp. Form.C29H33FN8O
Mol. Mass.528.6237
SMILESN[C@H]1CC[C@@H](CC1)Nc1nc(Nc2ccc(cc2)C(=O)N2CCCCC2)c2ncn(-c3cccc(F)c3)c2n1 |r,wU:4.7,wD:1.0,(-8.67,.31,;-7.34,-.46,;-7.34,-2,;-6,-2.77,;-4.67,-2,;-4.67,-.46,;-6,.31,;-3.33,-2.77,;-2,-2,;-2,-.46,;-.67,.31,;-.67,1.85,;.67,2.62,;2,1.85,;3.33,2.62,;3.33,4.16,;2,4.93,;.67,4.16,;4.67,4.93,;4.67,6.47,;6,4.16,;6,2.62,;7.34,1.85,;8.67,2.62,;8.67,4.16,;7.34,4.93,;.67,-.46,;2.13,.02,;3.04,-1.23,;2.13,-2.47,;2.9,-3.81,;2.13,-5.14,;2.9,-6.47,;4.44,-6.47,;5.21,-5.14,;6.75,-5.14,;4.44,-3.81,;.67,-2,;-.67,-2.77,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: