| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kaposi's sarcoma-associated herpesvirus cyclin homolog |
|---|
| Ligand | BDBM36461 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | KSHV Pr Inhibition Assay |
|---|
| pH | 8±0 |
|---|
| Temperature | 303.15±0 K |
|---|
| IC50 | 16.4±0.7 nM |
|---|
| Citation |  Shahian, T; Lee, GM; Lazic, A; Arnold, LA; Velusamy, P; Roels, CM; Guy, RK; Craik, CS Inhibition of a viral enzyme by a small-molecule dimer disruptor. Nat Chem Biol5:640-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Kaposi's sarcoma-associated herpesvirus cyclin homolog |
|---|
| Name: | Kaposi's sarcoma-associated herpesvirus cyclin homolog |
|---|
| Synonyms: | Kaposi's sarcoma-associated herpesvirus (KSHV) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28080.00 |
|---|
| Organism: | Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus) |
|---|
| Description: | Q98147 |
|---|
| Residue: | 257 |
|---|
| Sequence: | MATANNPPSGLLDPTLCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFS
VCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCY
AAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLI
TKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSGGVVPQLASILGCDVSVLQAAVE
QILTSVSDFDLRILDSY
|
|
|
|---|
| BDBM36461 |
|---|
| n/a |
|---|
| Name | BDBM36461 |
|---|
| Synonyms: | 3-Benzyl-4-(3-(cyclohexylmethyl)-4-methoxybenzamido)benzoic acid, 3 | CID42628633 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H31NO4 |
|---|
| Mol. Mass. | 457.5607 |
|---|
| SMILES | COc1ccc(cc1CC1CCCCC1)C(=O)Nc1ccc(cc1Cc1ccccc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
