| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Farnesyl pyrophosphate synthase |
|---|
| Ligand | BDBM36507 |
|---|
| Substrate/Competitor | BDBM36499 |
|---|
| Meas. Tech. | Biophysical assay |
|---|
| pH | 7.4±0 |
|---|
| Temperature | 296.15±0 K |
|---|
| IC50 | 5.0e+4±n/a nM |
|---|
| Citation |  Jahnke, W; Rondeau, JM; Cotesta, S; Marzinzik, A; Pellé, X; Geiser, M; Strauss, A; Götte, M; Bitsch, F; Hemmig, R; Henry, C; Lehmann, S; Glickman, JF; Roddy, TP; Stout, SJ; Green, JR Allosteric non-bisphosphonate FPPS inhibitors identified by fragment-based discovery. Nat Chem Biol6:660-6 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Farnesyl pyrophosphate synthase |
|---|
| Name: | Farnesyl pyrophosphate synthase |
|---|
| Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 48272.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14324 |
|---|
| Residue: | 419 |
|---|
| Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
|---|
| BDBM36507 |
|---|
| BDBM36499 |
|---|
| Name | BDBM36507 |
|---|
| Synonyms: | (R)-1-(benzyloxycarbonyl)indoline-2-carboxylic acid, 8 | CID6932062 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15NO4 |
|---|
| Mol. Mass. | 297.3053 |
|---|
| SMILES | OC(=O)[C@H]1Cc2ccccc2N1C(=O)OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
