Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM164 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
Ki | 0.02±n/a nM |
---|
Citation | De Lucca, GV; Liang, J; De Lucca, I Stereospecific synthesis, structure-activity relationship, and oral bioavailability of tetrahydropyrimidin-2-one HIV protease inhibitors. J Med Chem42:135-52 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM164 |
---|
n/a |
---|
Name | BDBM164 |
Synonyms: | (4R,5R,6R)-4-benzyl-5-hydroxy-1,3-bis(1H-indazol-5-ylmethyl)-6-(2-phenylethyl)-1,3-diazinan-2-one | CHEMBL288254 | Cyclic Urea | [4R-(4,5,6)]-Tetrahydro-5-hydroxy-1,3-bis(1H-indazol-5-ylmethyl)-4-(2-phenylethyl)-6-(phenylmethyl)-2(1H)-pyrimidinone |
Type | n/a |
Emp. Form. | C35H34N6O2 |
Mol. Mass. | 570.6835 |
SMILES | O[C@@H]1[C@@H](CCc2ccccc2)N(Cc2ccc3[nH]ncc3c2)C(=O)N(Cc2ccc3[nH]ncc3c2)[C@@H]1Cc1ccccc1 |
Structure |
|