Reaction Details |
| Report a problem with these data |
Target | Retinoic acid receptor alpha [200-419] |
---|
Ligand | BDBM36810 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Competitive Assay |
---|
pH | 8±0 |
---|
Temperature | 277.15±0 K |
---|
Ki | 2.0±0.0 nM |
---|
Citation | Géhin, M; Vivat, V; Wurtz, JM; Losson, R; Chambon, P; Moras, D; Gronemeyer, H Structural basis for engineering of retinoic acid receptor isotype-selective agonists and antagonists. Chem Biol6:519-29 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Retinoic acid receptor alpha [200-419] |
---|
Name: | Retinoic acid receptor alpha [200-419] |
Synonyms: | NR1B1 | Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | RARA | RARA_HUMAN | Retinoic Acid Receptor, alpha |
Type: | Ligand-binding domain |
Mol. Mass.: | 24746.59 |
Organism: | Homo sapiens (Human) |
Description: | P10276[200-419] |
Residue: | 220 |
Sequence: | PALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQIT
LLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPL
EMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLM
KITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
|
|
|
BDBM36810 |
---|
n/a |
---|
Name | BDBM36810 |
Synonyms: | BMS753 | US9963439, BMS753 |
Type | Small organic molecule |
Emp. Form. | C21H21NO4 |
Mol. Mass. | 351.3957 |
SMILES | CC1(C)C(=O)C(C)(C)c2cc(ccc12)C(=O)Nc1ccc(cc1)C(O)=O |
Structure |
|