BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP/microtubule affinity-regulating kinase 2
LigandBDBM6866
Substrate/Competitorn/a
Meas. Tech.Kinase Inhibitor Selectivity Profiling Assay
Kd 1200±n/a nM
Citation PubChem PC Kinase Inhibitor Selectivity Profiling Assay PubChem Bioassay (2008)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MAP/microtubule affinity-regulating kinase 2
Name:MAP/microtubule affinity-regulating kinase 2
Synonyms:ELKL motif kinase 1 | EMK1 | MARK2 | PAR1 homolog | Par-1 | Serine/threonine-protein kinase MARK2
Type:PROTEIN
Mol. Mass.:87953.09
Organism:Homo sapiens (Human)
Description:ChEMBL_774586
Residue:788
Sequence:
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTST
NRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHP
NKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPE
SKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDA
NSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIAS
KIANELKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6866
n/a
NameBDBM6866
Synonyms:1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b | 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzene-1-sulfonamide | 4-[[5-Amino-1-(2,6-difluorobenzoyl)-1H-1,2,4-triazol-3-yl]amino]-benzenesulfonamide | CHEMBL191003 | JNJ-7706621 | cid_5330790
TypeSmall organic molecule
Emp. Form.C15H12F2N6O3S
Mol. Mass.394.356
SMILESNc1nc(Nc2ccc(cc2)S(N)(=O)=O)nn1C(=O)c1c(F)cccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: