| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member C3 |
|---|
| Ligand | BDBM264516 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | AKR1C3-Inhibitory Action |
|---|
| pH | 7±n/a |
|---|
| IC50 | 6.00±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Bothe, U; Busemann, M; Barak, N; Rotgeri, A; Fischer, OM; Marquardt, T Estra-1,3,5(10),16-tetraene-3-carboxamides for inhibition of 17.beta.-hydroxysteroid dehydrogenase (AKR1C3) US Patent US9714266 Publication Date 7/25/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member C3 |
|---|
| Name: | Aldo-keto reductase family 1 member C3 |
|---|
| Synonyms: | 17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3) | 3-alpha-HSD type 2 | AK1C3_HUMAN | AKR1C3 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Aldo-keto-reductase family 1 member C3 | DDH1 | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | HSD17B5 | KIAA0119 | PGFS | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36859.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P42330 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
|
|
|
|---|
| BDBM264516 |
|---|
| n/a |
|---|
| Name | BDBM264516 |
|---|
| Synonyms: | 17-(5-fluoropyridin-3-yl)-N?[(S)-2-hydroxypropyl]oestra-1,3,5(10),16-tetraene-3-carboxamide | US9714266, 46 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H33FN2O3 |
|---|
| Mol. Mass. | 464.5716 |
|---|
| SMILES | C[C@]12CC[C@H]3[C@@H](CCc4cc(ccc34)C(=O)NCCOCCO)[C@@H]1CC=C2c1cncc(F)c1 |r,c:28| |
|---|
| Structure | 
|
|---|
Search and Browse
