| Reaction Details |
|---|
 | Report a problem with these data |
| Target | fMet-Leu-Phe receptor |
|---|
| Ligand | BDBM37667 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response Assay for Formylpeptide Receptor (FPR) Ligands and Dose Response Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands |
|---|
| Ki | 3300±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response Assay for Formylpeptide Receptor (FPR) Ligands and Dose Response Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands PubChem Bioassay(2007)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| fMet-Leu-Phe receptor |
|---|
| Name: | fMet-Leu-Phe receptor |
|---|
| Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38456.14 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_4503779 |
|---|
| Residue: | 350 |
|---|
| Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
|---|
| BDBM37667 |
|---|
| n/a |
|---|
| Name | BDBM37667 |
|---|
| Synonyms: | 4-[(E)-[4,5-diketo-1-(2-morpholinoethyl)-2-(2-thienyl)pyrrolidin-3-ylidene]-hydroxy-methyl]-3,5-dimethyl-1H-pyrrole-2-carboxylic acid methyl ester | 4-[(E)-hydroxy-[1-[2-(4-morpholinyl)ethyl]-4,5-dioxo-2-thiophen-2-yl-3-pyrrolidinylidene]methyl]-3,5-dimethyl-1H-pyrrole-2-carboxylic acid methyl ester | MLS000081406 | SMR000045473 | cid_5389834 | methyl 3,5-dimethyl-4-[(E)-[1-(2-morpholin-4-ylethyl)-4,5-bis(oxidanylidene)-2-thiophen-2-yl-pyrrolidin-3-ylidene]-oxidanyl-methyl]-1H-pyrrole-2-carboxylate | methyl 4-[(E)-hydroxy-[1-(2-morpholin-4-ylethyl)-4,5-dioxo-2-thiophen-2-ylpyrrolidin-3-ylidene]methyl]-3,5-dimethyl-1H-pyrrole-2-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27N3O6S |
|---|
| Mol. Mass. | 473.542 |
|---|
| SMILES | COC(=O)c1[nH]c(C)c(C(=O)C2C(N(CCN3CCOCC3)C(=O)C2=O)c2cccs2)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
