| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N-formyl peptide receptor 2 |
|---|
| Ligand | BDBM37686 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Dose Response Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands |
|---|
| Ki | 7300±n/a nM |
|---|
| Comments | Extracted from aid = 520 and tid = 2 |
|---|
| Citation |  PubChem, PC Dose Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Dose Response Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands PubChem Bioassay(2007)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N-formyl peptide receptor 2 |
|---|
| Name: | N-formyl peptide receptor 2 |
|---|
| Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38968.35 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25090 |
|---|
| Residue: | 351 |
|---|
| Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
|---|
| BDBM37686 |
|---|
| n/a |
|---|
| Name | BDBM37686 |
|---|
| Synonyms: | 2-(4-benzylpiperazin-1-yl)-4-(3,4-dimethoxyphenyl)-6-(trifluoromethyl)pyrimidine | 2-(4-benzylpiperazino)-4-(3,4-dimethoxyphenyl)-6-(trifluoromethyl)pyrimidine | 4-(3,4-dimethoxyphenyl)-2-[4-(phenylmethyl)-1-piperazinyl]-6-(trifluoromethyl)pyrimidine | 4-(3,4-dimethoxyphenyl)-2-[4-(phenylmethyl)piperazin-1-yl]-6-(trifluoromethyl)pyrimidine | MLS000044552 | SMR000022329 | cid_2992722 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H25F3N4O2 |
|---|
| Mol. Mass. | 458.4761 |
|---|
| SMILES | COc1ccc(cc1OC)-c1cc(nc(n1)N1CCN(Cc2ccccc2)CC1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
